General Information

  • ID:  hor004668
  • Uniprot ID:  G7ZZZ3
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 12
  • Gene name:  CLE12
  • Organism:  Medicago truncatula (Barrel medic) (Medicago tribuloides)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE12p]: Induced in roots during nodulation triggered by low nitrogen and infection with Sinorhizobium meliloti. |[CLE12p]: Expressed in young nodules throughout the central tissue .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Medicago (genus), Trifolieae (tribe), IRL clade, Hologalegina, NPAAA clade, 50 kb inversion clade, Papilionoideae (subfamily), Fabaceae (family), Fabales (order), fabids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LEGGSNIDSQRLLHELMVDRIKQKRSRTDLEDKAVPGDRLSPGGPNHIHN
  • Length:  50
  • Propeptide:  MENSNKVPISKIGLIMLMIFSTFFMSPHARRLEGGSNIDSQRLLHELMVDRIKQKRSRTDLEDKAVPGDRLSPGGPNHIHN
  • Signal peptide:  MENSNKVPISKIGLIMLMIFSTFFMSPHARR
  • Modification:  T42 Hydroxyproline;T45 Hydroxyproline
  • Glycosylation:  T45 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Signaling peptide involved in the regulation of nodulation.
  • Mechanism:  Moves from root to shoot to function with the receptor kinase SUNN, in a signaling pathway that plays roles during cellular differentiation, both at the onset of nodulation, and later during nodule meristem development and subsequent homeostasis. Interacts with SUNN signaling to control nodule numbers. SUNN is involved in the autoregulation of nodulation (AON), a long distance systemic signaling from root to shoot and back again, which allows legumes to limit the number of root nodules formed based on available nitrogen and previous rhizobial colonization (Probable).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G7ZZZ3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004668_AF2.pdbhor004668_ESM.pdb

Physical Information

Mass: 647546 Formula: C236H393N79O77S
Absent amino acids: CFWY Common amino acids: LDGR
pI: 7.81 Basic residues: 11
Polar residues: 13 Hydrophobic residues: 12
Hydrophobicity: -103.2 Boman Index: -15521
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 83.8
Instability Index: 7819 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  28592666
  • Title:  ROOT DETERMINED NODULATION1 Is Required for M. truncatula CLE12, But Not CLE13, Peptide Signaling Through the SUNN Receptor Kinase